PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g045079m
Common NameCISIN_1g045079mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 596aa    MW: 66859.9 Da    PI: 6.4722
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g045079mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.22.3e-883125952288
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        + lL+ cA+av+s+d++ a++ L++++ ++s  gd +qRla+yf+ AL+arl++  + +   +++++++    ++ l+a+++   + P++++
  orange1.1g045079m 312 RGLLTLCAQAVASNDQRTANEQLKQIRRHSSAFGDGTQRLAHYFADALEARLLGAHTPMHTHISCRTSA----ADILKAYQMSLSAWPFIRM 399
                        67999*************************************************999999999999886....9********9********* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s+l aNq+I + +e+++r+HiiDf+i +G+QWp+L+q L+sRp gpp+lRiTg++ p++g   +e++eetg+rL++++e+++vpfe+nv +a
  orange1.1g045079m 400 SYLFANQTIRKLAEKATRLHIIDFGICYGFQWPCLIQILSSRPTGPPMLRITGIELPQPGfrPAERVEETGNRLKSYCERFNVPFEYNV-IA 490
                        ***********************************************************9****************************9.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++e+++le+++++++E+++Vn+v+++++l+d++v  +s+rd+vL+l+k+++P+v+++  ++  +n++ Fl+rf eal ++sa+fd ++a++
  orange1.1g045079m 491 QKWETIRLEDFKIDRDEVTVVNCVHRMKNLPDDTVVDSSPRDAVLDLIKRINPDVFIHGISNGTYNAPFFLARFREALFHFSAMFDIFDATV 582
                        ******************************************************************************************** PP

               GRAS 276 preseerikvEre 288
                        pre+ er+  Ere
  orange1.1g045079m 583 PREDAERMLFERE 595
                        ********99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.189285596IPR005202Transcription factor GRAS
PfamPF035147.8E-86312595IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MDAIFEGFPG SMDGFKFPAS SCSNQNLANA FKLKHNSTNH HPPFLETNPH PPADDNLNSD  60
GDSPDSSDFS NAVLKYISEI LMEEDLEGKT CMLQDCLALQ AAEKSFYDVL GQKYPPSLNH  120
VLPSLGQNID TPDVHYTSSS SGSSSSDHSF STSNCLLDSP ESNLLVPNLH GEIESLLKRE  180
GVNFAPKVSL PKHGEGVLLS SADDGRHHSS YGSRGRKNDQ REDSDYLEQG RRSKLSAVSL  240
AVSDVKLERF DEVLLRHCET KKDESEPYSS YRESENGSSR KLQQNGQSKG STGGTTRGRK  300
RGDKRKEVVD LRGLLTLCAQ AVASNDQRTA NEQLKQIRRH SSAFGDGTQR LAHYFADALE  360
ARLLGAHTPM HTHISCRTSA ADILKAYQMS LSAWPFIRMS YLFANQTIRK LAEKATRLHI  420
IDFGICYGFQ WPCLIQILSS RPTGPPMLRI TGIELPQPGF RPAERVEETG NRLKSYCERF  480
NVPFEYNVIA QKWETIRLED FKIDRDEVTV VNCVHRMKNL PDDTVVDSSP RDAVLDLIKR  540
INPDVFIHGI SNGTYNAPFF LARFREALFH FSAMFDIFDA TVPREDAERM LFEREI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-383115965287GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424857.10.0hypothetical protein CICLE_v10027940mg
RefseqXP_006488349.10.0PREDICTED: scarecrow-like protein 30
TrEMBLA0A067FZM20.0A0A067FZM2_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-135GRAS family protein